UGA logo RCC: Research Computing Center
 
 
Home >
 
 
RESOURCES
SERVICES
Application & Code Development
Consulting
Grantwriting Support

Formatdb

Table of Contents


Introduction

Formatdb must be used in order to format protein or nucleotide source databases before these databases can be searched by blastall, blastpgp or MegaBLAST. The source database may be in either FASTA or ASN.1 format. Although the FASTA format is most often used as input to formatdb, the use of ASN.1 is advantageous for those who are using ASN.1 as the common source for other formats such as the GenBank report. Once a source database file has been formatted by formatdb it is not needed by BLAST. Please note that formatdb does not create non-redundant blast databases.

If you are having problems formatting a BLAST databases please scroll down to the "Formatdb Notes/Troubleshooting" section below. Or contact the BLAST Desk at blast-help@ncbi.nlm.nih.gov


Quick Start

1. Download sequences at NCBI:
    a. Go to NCBI GenBank, search sequences.
    b. Click results at Nucleotide, Protein or others, at Display, select FASTA, at Send to, select file
    c. save the file, and transfer to your local directory at rcluster

2. formatdb -p F sequencefile
where sequencefile is the FASTA file. The -p F indicates that they are nucleotides, and not proteins (i.e, protein = false). This process will create three files which are the blast database, and you simply blast against the name of it, not including the *.n* extensions the files will have e.g., myseqs.nhn would represent a database named "myseqs".


Command Line Options

A list of the command line options and the current version for formatdb may be obtained by executing formatdb without options, as in:

formatdb -

The formatdb options are summarized below:

formatdb 2.2.5 arguments:

  -t  Title for database file [String]  
  Optional
  -i  Input file(s) for formatting (this parameter must be set)
  [File In]
  -l  Logfile name: [File Out]  
  Optional
  default = formatdb.log
  -p  Type of file
  T - protein
  F - nucleotide [T/F]  Optional
  default = T
  
  -o  Parse options
  T - True: Parse SeqId and create indexes.
  F - False: Do not parse SeqId. Do not create indexes.
  [T/F]  Optional default = F

If the "-o" option is TRUE (and the source database is in FASTA format), then the database identifiers in the FASTA definition line must follow the convention of the FASTA Defline Format. Please see section "F Note on creating custom databases" below.

-a  Input file is database in ASN.1 format (otherwise FASTA is expected)
  T - True,
  F - False.
  [T/F]  Optional default = F
  
  -b  ASN.1 database in binary mode
  T - binary,
  F - text mode.
  [T/F]  Optional default = F

A source ASN.1 database may be represented in two formats - ascii text and binary. The "-b" option, if TRUE, specifies that input ASN.1 database is in binary format. The option is ignored in case of FASTA input database.

 -e  Input is a Seq-entry [T/F]  
  Optional
  default = F

A source ASN.1 database (either text ascii or binary) may contain a Bioseq-set or just one Bioseq. In the latter case the "-e" switch should be set to TRUE.

 -n  Base name for BLAST files [String]  
  Optional

This options allows one to produce BLAST databases with a different name than that of the original FASTA file. For instance, one could have a file named 'ecoli.nuc.txt' and and format it as 'ecoli':

formatdb -i ecoli.nuc.txt -p F -o T -n ecoli
  
  uncompress -c nr.z | formatdb -i stdin -o T -n nr

This can be used in situations where the original FASTA file is not required other than by formatdb. This can help in a situation where disk-space is tight.

-v  Database volume size in millions of letters [Integer] Optional
  default = 0
  range from 0 to <NULL>

This option breaks up large FASTA files into 'volumes' (each with a maximum size of 2 billion letters). As part of the creation of a volume formatdb writes a new type of BLAST database file, called an alias file, with the extension 'nal' or 'pal'.

 -s  Create indexes limited only to accessions - sparse [T/F]  
  Optional
  default = F

This option limits the indices for the string identifiers (used by formatdb) to accessions (i.e., no locus names). This is especially useful for sequences sets like the EST's where the accession and locus names are identical. Formatdb runs faster and produces smaller temporary files if this option is used. It is strongly recommended for EST's, STS's, GSS's, and HTGS's.

-L  Create an alias file with this name
  use the gifile arg (below) if set to calculate db size
  use the BLAST db specified with -i (above) [File Out]  Optional

This option produces a BLAST database alias file using a specified database, but limiting the sequences searched to those in the GI list given by the -F argument. See the section "Note on creating an alias file for a GI list" for more information.

-F  Gifile (file containing list of gi's) [File In]  Optional

This option can be used to specify the GI list for the alias file construction (-L option above) or to produce a binary GI list if the -B option (below) is set.

-B  Binary Gifile produced from the Gifile specified above [File Out]  
    Optional

This option specifies the name of a binary GI list file. This option should be used with the -F option. A text GI list may be specified with the -F option and the -B option will produce that GI list in binary format. The binary file is smaller and BLAST does not need to convert it, so it can be read faster.


Configuration

File ------------------

Starting from formatdb version 4, we have added a configuration file to allow flexibility in specifying the membership and link bits to set in the ASN.1 defline structures. This feature is available by recompiling the formatdb binary with the following compile time flag: -DSET_ASN1_DEFLINE_BITS. The membership bit arrays are used to help distinguish sequences that belong to a subset database (e.g.: pdb, swissprot) in a non-redundant database (e.g.: nr). The link bit arrays are used to indentify which sequences should have a user specified "link out" in the blast (html) report. These features are still under development and useful within NCBI only. A sample configuration file follows:

; .formatdbrc: formatdb configuration file
;
; This information is needed for the new database format, to set
; the links and membership information of the structured deflines.
    
;;;;;;;;;;;;;;;;;;; Memberships section ;;;;;;;;;;;;;;;;;;;;;;
; This section determines what the bits mean in the membership bit array.
; These must be unique positive integers starting with 1.
; When adding a new entry, remember to update the value of TotalNum  
; This information is used to distinguish database subsets (e.g.: pdb,
; swissprot) in non-redundant databases (e.g.: nr).
[MembershipBitNumbers]
TotalNum = 3
1  = swissprot
2  = pdb
3  = refseq_protein
    
;;;;;;;;;;;;;;;;;;;;;;;; Links section ;;;;;;;;;;;;;;;;;;;;;;;;;;
; This section determines what the bits mean in the links bit array.
; These must be unique positive integers starting with 1.
; When adding a new entry, remember to update the value of TotalNum and 
; adding the appropriate file paths for each database in the LinkFiles 
; section.
; This is used for the link out feature of the blast result formatter.
[LinkBitNumbers]
TotalNum = 4   ; total number of bits used so far
1 = LocusLink
2 = UniGene
3 = Structure
4 = Geo
    
; These are the paths to the files containing the
; gi's whose links will be modified. The format is
; <link_type> = <file_path>
; where link_type is one of the types of links defined in the 
; LinkBitNumbers section.
[LinkFiles]
LocusLink = /home/joe/locus_gis.txt
UniGene   = /dev/null
Structure = /dev/null
Geo       = /home/john/geo.txt
; EOF

Notes/Troubleshooting:

A.) Note on -o option:

It is always advantageous to use the '-o' option if the database identifiers are in the format specified at ftp://ftp.ncbi.nih.gov/blast/db/README. If the database identifiers are in this parseable format, formatdb produces additional indices allowing retrieval from the databases by identifier. The databases on the NCBI FTP site contain parseable identifiers. It is sufficient if the first word on the FASTA definition line is a unique identifier (e.g., ">3091 Alcoho de..."). It is necessary to use parseable identifiers for the following cases:

1.) ASN.1 is to be produced from blastall or blastpgp, then "-o" must be TRUE.

2.) query-anchored alignments are desired (i.e., the '-m' option with a non-zero value is used).

3.) The gi's are desired as part of the output (i.e., '-I' is used).

4.) fastacmd will be used to fetch sequences from the database by accession or gi.

See Appendix 1: The Files Produced by Formatdb for more information in the -o T option.

B.) Note on "SORTFiles failed" message:

Formatdb will use the 'standard' temporary directory to sort the string indices on disk. Under UNIX this directory is often /var/tmp and if there is not enough space there, then the error message: "ERROR: [000.000] SORTFiles failed" will be issued. This can be avoided by setting the TMPDIR environment variable to a partition with more free space. This message may also often be avoided by using the sparse option (-s) for formatdb described above.

C.) Note on formatting large (4 Gig and larger) FASTA files:

A single BLAST database can contain up to 4 billion letters. If one wishes to formatdb a FASTA file containing more letters than this, several databases, each of a maximum size of 4 billion bases, will be produced. This will be done automatically if the -v argument is not set. One may also specify a smaller size for the volume databases by using the -v option:

formatdb -i hugefasta -p F -v 2000000000

This command line will format the "hugefasta" FASTA file as a number of database "volumes," each containing a maximum of two billion base pairs, as specified by the "-v" option. Two billion is the current limitation on the NCBI toolkit command-line parser. The volumes will have names consisting of the root database name, "hugefasta" followed by a two-digit volume extension, followed by the usual BLAST database extensions. These smaller databases can be searched as if they were a single entity using:

blastall -i infile -d hugefasta -p blastn -o out

In this case, BLAST recognizes that the database "hugefasta" has been partitioned into several volumes because it detects a file with the name of the root database followed by an extension of "nal" (for protein databases, the extension is "pal"). This file specifies a database list to be searched when the root database name is specified to BLAST. BLAST sequentially searches each database listed in this "nal" file and generates output that is indistinguishable from that of a single database search. A sample "nal" file, resulting from formatting the datafile "hugefasta" into three volumes, is given below. The "DBLIST" line can also be edited to specify additional databases to be searched.

	     #
      # Alias file created Tue Jan 18 13:12:24 2000
      #
      #
      TITLE hugefasta
      #
      DBLIST hugefasta.00 hugefasta.01 hugefasta.02
      #
      #GILIST
      #
      #OIDLIST
      #

The "nal" and "pal" files can also be used to simplify searches of multiple databases created separately. For instance, a file called "multi.nal" containing the following lines could be created from scratch using a text editor.

      #
      # Alias file created Tue Jan 18 13:12:24 2000
      #
      #
      TITLE multi
      #
      DBLIST part1 part2 part3
      #
      #GILIST
      #
      #OIDLIST
      #

The "multi.nal" file would allow the three databases, "part1", "part2", and "part3", to be searched by specifying a single database name, "multi", on the blastall command line as follows:

blastall -i infile -d multi -p blastn -o out

The reason for using database volumes, as opposed to simply making the indices in the BLAST databases large enough to handle all conceivable databases with an eight-byte 'integer', is that this would have doubled the size of the indices for all searches no matter how small the database. Hence very large FASTA files are broken down into a couple of databases.

Formatdb must be able to open files larger than 2 Gig in order to work on very large files. This is not a problem on a 64-bit OS and on certain 32-bit OS that allows binaries to be made large-file aware. The 32-bit Solaris formatdb binary on the NCBI FTP site is now compiled large file aware.

D.) Note on running formatdb on a database without uncompressing it:

Under UNIX it is possible to uncompress a database on the fly and pipe it to formatdb. This can reduce the disk-space needed for running formatdb on a large database. In addition, some operating systems cannot write files larger than 2 Gig to disk. To circumvent this on Unix or Linux systems, use a "pipe" system such as:

uncompress -c nt.Z|formatdb -i stdin -o T -p T -n "nt" -v 100000000

In this case, no file is written which is larger than 1 Gig and an arbitrarily large database is formatted as a set of 1 Gig volumes. Note the use of the '-n' option that specifies the name of the resulting BLAST database. Note also that 'stdin' specifies that input will be coming from 'standard input'. The nt FASTA file is not needed for running BLAST searches and nt.Z may be deleted after formatdb has been run.

E) Note on creating custom databases:

With Standalone BLAST it is possible to take any custom file of FASTA sequences and use these as a database source file for searching. All BLAST database source files must be in FASTA format. In order to use the formatdb option -o T, especially for use with NCBI tool kit retrieval tools the FASTA defline must follow a specific format.

F) Note on creating an alias file for a GI list:

Formatdb can now produce a BLAST database alias file that specifies a (real) BLAST database to search as well as a GI list to limit the search. This is useful if one often searches a subset of a database (e.g., based on organism or a curated list). The alias file makes the search appear as if one were searching a real database rather than the subset of one. The procedure to produce an alias file for searching (protein) nr limiting it to a list of zebrafish GI's would be:

1.) obtain the list of zebrafish GI's from Entrez or some other source and keep it in a file called "zebrafish.gi.in".

2.) invoke formatdb to convert the text GI list to the more efficient binary format:

formatdb -F zebrafish.gi.in -B zebrafish.gi 

3.) invoke formatdb with the following options:

formatdb -i nr -p T -L zebrafish -F zebrafish.gi -t "My zebrafish database"

This will produce the alias file zebrafish.pal listing the database title, the real database to be searched, the GI file, and some statistics:

#
# Alias file created Thu Jul  5 15:04:29 2001
#
#
TITLE My zebrafish database
#
DBLIST nr
#
GILIST zebrafish.gi
#
#OIDLIST
#
NSEQ 1836
LENGTH 640724

One can search this by invoking (for example):

blastall -p blastp -d zebrafish -i MYQUERY -o MYOUTPUT

NOTE: One may wish to prepare the alias file in one directory, but move it to a different production directory that does not contain the real database. In that case you may use the '-n' option to specify a path to the real database in the production environment. In the example below the -n option is used to specify that the nr database can really be found at a relative path of ../../newest_blast/blast

formatdb -i nr -n ../../newest_blast/blast/nr -p T -L zebrafish -F 
     zebrafish.gi -t "My zebrafish database"

and the alias file will be:

#
# Alias file created Wed Nov 28 13:55:41 2001
#
#
TITLE My zebrafish database
#
DBLIST ../../newest_blast/blast/nr
#
GILIST zebrafish.gi
#
#OIDLIST
#
NSEQ 1836
LENGTH 640724

Notes on Version 4 of the BLAST databases

Version 4 of the BLAST databases address some important shortcomings of the current (version 4) databases:

1.) Version 3 does not handle ambiguity characters correctly if a database sequence is longer than about 16 million bases which may lead to incorrect results. The new version does.

2.) Version 3 only allows one volume of a BLAST database to contain at most about 4 billion bases. The new databases allows that to be much larger.

PLEASE NOTE THAT VERSION 3 OF THE BLAST DATABASES WILL NO LONGER BE SUPPORTED.

The new databases keep the sequence descriptors in a structured format (ASN.1) and some new information has been put into those fields.

The new information is:

1.) taxid. This integer specifies the taxonomy of the sequence and will allow greater flexibility in how taxonomic information is presented in a future version of BLAST.

2.) link bits. These specify whether LinkOut information about the database sequence is available and permits the additon of a gif with a link to the relevant page. in a future version of BLAST.

3.) membership bits. These specify that a given gi in a database also belongs to a subset database. An example of this relationship is the EST's database. Est contains all EST's, but also comprises est_human, est_mouse and est_others; with the new membership bit it will be possible to search any of the subset est databases with only the main est database and two other small files (an alias file and an "oidlist").

This can reduce the amount of disk-space and memory needed by half in this case. It is expected that the proper alias file and oidlist for searching such subsets will be made available on the NCBI FTP site in mid January.

FASTA Defline Format

The syntax of FASTA Deflines used by the NCBI BLAST server depends on the database from which each sequence was obtained. The table below lists the identifiers for the databases from which the sequences were derived.

Database Name                         Identifier Syntax
		    
GenBank                               gb|accession|locus
EMBL Data Library                     emb|accession|locus
DDBJ, DNA Database of Japan           dbj|accession|locus
NBRF PIR                              pir||entry
Protein Research Foundation           prf||name
SWISS-PROT                            sp|accession|entry name
Brookhaven Protein Data Bank          pdb|entry|chain
Patents                               pat|country|number 
GenInfo Backbone Id                   bbs|number 
General database identifier           gnl|database|identifier
NCBI Reference Sequence               ref|accession|locus
Local Sequence identifier             lcl|identifier

For example, an identifier might be "gb|M73307|AGMA13GT", where the "gb" tag indicates that the identifier refers to a GenBank sequence, "M73307" is its GenBank ACCESSION, and "AGMA13GT" is the GenBank LOCUS.

"gi" identifiers are being assigned by NCBI for all sequences contained within NCBI's sequence databases. The 'gi' identifier provides a uniform and stable naming convention whereby a specific sequence is assigned its unique gi identifier. If a nucleotide or protein sequence changes, however, a new gi identifier is assigned, even if the accession number of the record remains unchanged. Thus gi identifiers provide a mechanism for identifying the exact sequence that was used or retrieved in a given search.

For searches of the nr protein database where the sequences are derived from conceptual translations of sequences from the nucleotide databases the following syntax is used:

gi|gi_identifier

An example would be:

gi|451623           (U04987) env [Simian immunodeficiency..."

where '451623' is the gi identifier and the 'U04987' is the accession number of the nucleotide sequence from which it was derived.

Users are encouraged to use the '-I' option for Blast output which will produce a header line with the gi identifier concatenated with the database identifier of the database from which it was derived, for example, from a nucleotide database:

gi|176485|gb|M73307|AGMA13GT

And similarly for protein databases:

gi|129295|sp|P01013|OVAX_CHICK

The gnl ('general') identifier allows databases not on the above list to be identified with the same syntax. An example here is the PID identifier:

gnl|PID|e1632

PID stands for Protein-ID; the "e" (in e1632) indicates that this ID was issued by EMBL. As mentioned above, use of the "-I" option produces the NCBI gi (in addition to the PID) which users can also retrieve on.

The bar ("|") separates different fields as listed in the above table. In some cases a field is left empty, even though the original specification called for including this field. To make these identifiers backwards-compatiable for older parsers the empty field is denoted by an additional bar ("||").

BLAST Databases without GI's or GenBank accessions

Some BLAST users wish to format a FASTA file of sequences that do not contain NCBI ID's such as accessions or GI numbers. This may be the case if the sequences have not yet been submitted to GenBank or are proprietary. If the only goal is to perform BLAST searches and format a standard BLAST report then the simplest solution is to not set the "-o" option when running formatdb and indices for the identifiers will not be constructed. If one wishes to produce XML or ASN.1 output or wants to fetch sequences by ID with fastacmd, it is necessary to observe a few simple rules when constructing the ID's. These rules are necessary to ensure that the ID's can be reliably parsed to make the ID indices.

1.) ID's of type "local" or "general" should be used. This means that the ID's will have the syntax "lcl|IDENTIFIER" (for "local") or "gnl|DATABASE|IDENTIFIER" (for "general"). The tokens DATABASE and IDENTIFIER should be assigned by the user here. The local ID has only one user provided token, the general ID requires two. The fields are separated by vertical bars ("|")..

2.) Letters, numbers, underscores ("_"), dashes, and periods may be used. Uppercase and lowercase letters are treated as being distinct. No spaces are allowed in the ID, this indicates the end of the ID.

3.) All ID's should be unique, if the entire ID is examined. As an example consider the following four ID's:

gnl|H.sapiens|seq1
gnl|H.sapiens|seq2
gnl|M.Mus|seq1
lcl|seq1

All of these ID's are considered unique. The first two might be sequences one and two of a collection of Human sequences; the fourth might be the first sequence in a collection of mouse sequences; the fourth is simply identified as the first sequence.

ID's must fit into the framework described above to ensure that they can be reliably parsed and indices built for them. This means that it is not possible for users to invent new ID formats on the fly. Examples of illegal ID's would be:

H.sapiens|seq1
gnl|H.sapiens|seq1|A

The first identifier is missing a database tag (e.g., no "lcl"), the second identifier has an extra field since vertical bars separate fields. Illegal ID's will not be processed by formatdb if the "-o" option is used.

G). General troubleshooting tips.

The Latest Version: Make sure you are using the latest version of the formatdb executable. Earlier versions of formatdb may not recognize changes in the ASN.1 or FASTA definition line format of current BLAST databases or other sources of NCBI sequences.

H). Troubleshooting "SeqIdParse Failure" errors.

The most frequent cause of SeqIdParse Failure errors come from the syntax of the FASTA definition lines in the source database file. Many third parties do not follow the syntax in section F. If you are getting a SeqIdParse error this can often be eliminated by formatting the database with the -o option set to FALSE (e.g. -o F). The -o option is really not important for BLAST searching unless you are going to use the results to parse out the identifiers for searching Entrez and downloading the sequences. If you need to use the -o T option then your best option is to examine the definition lines of the database sequences and attempt to make them conform the FASTA syntax.

I). Troubleshooting "FileOpen" errors.

This is caused when the formatdb program can not find the /data subdirectory. When you download and extract the Standalone BLAST executables, the formatdb program is located in the same directory as the /data subdirectory. If either if these move, formatdb will not function without a .ncbirc file telling it where the /data subdirectory resides. Create a text file in the same directory as formatdb that contains the following lines:

[NCBI] 
Data="path/data/"

Where "path/data/" is the path to the location of the Standalone BLAST "data" subdirectory. For Example:

Data=/root/blast/data

For PC's this would be:

  [NCBI] 
Data="C:\path\data\"

Where "C:path\data\" is the path to the location of the Standalone BLAST "data" subdirectory. For example:

Data=C:\blast\data

For Macintosh this would be a simpletext file called "ncbi.cnf", placed in System folder, that contains:

[BLAST]
BLASTDB=root:blast:data

Where "root:blast:data" is the path to the location of the Standalone BLAST "data" subdirectory. For example on the machine names "LabMac":

BLASTDB=LabMac:blast:data

Appendix

1: The Files Produced by Formatdb ------------------------------------------

Using formatdb without the "-o T" indexing option results in three BLAST database files (.nhr, .nin, ,nsq). Using the "-o T" option will result in additional files.

If gi's are present in the FASTA definition lines of the source file, there will be four additional files created (.nsd, nsi, nni, nnd). These are ISAM indices for mapping a sequence identifier to a particular sequence in the BLAST database. If gi's are not use there will be only two additional files created (.nsd, .nsi).

These files are listed below for both an example nucleotide and a protein sequence database. The actual sequence data is stored in the files with extension "nsq" or "psq". The compression ratio for these files is about 4:1 for nucleotides and 1:1 for protein sequence source files.

Extension    Content        Format        
 ---------------------------------------------
Nucleotide database formatted without "-o T"
		         
nhr          deflines       binary    
		         
nin          indices        binary       
		         
nsq        sequence data    binary

Nucleotide database formatted with "-o T" add these ISAM files:

nnd          GI data        binary        
		         
nni          GI indices     binary        
		         
nsd          non-GI data    binary        
		         
nsi         non-GI indices  binary 

The formatdb index files involving deflines are small relative to the source database due to entries such as the one below in which the defline is much shorter than the sequence.

>gi|5819095|ref|NC_001321.1| Balaenoptera physalus mitochondrion,
complete genome GTTAATTACTAATCAGCCCATGATCATAACATAACTGAGGTTTCATACATTTGGTA
TTTTTTTATTTTTTTTGGGGGGCTTGCACGGACTCCCCTATGACCCTAAAGGGTCTCGTCGCAGTCAGATAA
ATTGTAGCTGGGCCTGGATGTATTTGTTATTTGACTAGCACAACCAACATGTGCAGTTAAATTAATGGTTAC
AGGACATAGTACTCCACTATTCCCCCCGGGCTCAAAAAACTGTATGTCTTAGAGGACCAAACCCCCCTCCTT
CCATACAATACTAACCCTCTGCTTAGATATTCACCACCCCCCTAGACAGGCTCGTCCCTAGATTTAAAAGCC
ATTTTATTTATAAATCAATACTAAATCTGACACAAGCCCAATAATGAAAATACATGAACGCCATCCCTATCC
AATACGTTGATGTAGCTTAAACACTTACAAAGCAAGACACTGAAAATGTCTAGATGGGTCTAGCCAACCCCA
TTGACATTAAAGGTTTGGTCCCAGCCTTTCTATTAGTTCTTAACAGACTTACACATGCAAGTATCCACATCC
CAGTGAGAACGCCCTCTAAATCATAAAGATTAAAAGGAGCGGGTATCAAGCACGCTAGCACTAGCAGCTCAC
AACGCCTCGCTTAGCCACGCCCCCACGGGACACAGCAGTGATAAAAATTAAGCTATAAACGAAAGTTCGACT
AAGTCATGTTAATTTA
....16398 bp total
Extension    Content        Format            
------------------------------------------
Protein database formatted without "-o T
		         
phr        deflines         binary    
		         
pin        indices          binary       
		         
psq        sequence data    binary        
		         
Protein database formatted with "-o T" add these ISAM files:
		         
pnd        GI data          binary        
		         
pni        GI indices       binary        
		         
psd        non-GI data      binary        
		         
psi        non-GI indices   binary  

The formatdb index files involving deflines are large relative to the source database due to entries such as the one below in which the defline is much longer than the sequence.

>gi|229659|pdb|1AAP|A Chain A, Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor (APPI)gi|229660|pdb|1AAP|B Chain B, Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor (APPI) VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSA

DISCLAIMER: The internal structure of the BLAST databases is subject to change with little or no notice. The readdb API should be used to extract data from the BLAST databases. Readdb is part of the the NCBI toolkit (ftp://ftp.ncbi.nih.gov/toolbox/ncbi_tools/), readdb.h contains a list of supported function calls.

Last updated January 30 2004

 
Partnering with UGA